DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GSTF5

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:219 Identity:58/219 - (26%)
Similarity:92/219 - (42%) Gaps:41/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLYNMSGSP---STRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIW 63
            |.|.:.|.|   :||.|:......|:.::.|.||...|:|.:|.|:.|||...:|..:|....:.
plant    62 DEYKIYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLT 126

  Fly    64 ETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGT--LYDGIAKY-FFPL---------- 115
            |:|||..|:...:        |....| |:|.:.|..|||  ::..|..: |.||          
plant   127 ESRAISEYIATVH--------KSRGTQ-LLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSI 182

  Fly   116 -----LRTGKPGTQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKK 175
                 |:|......|...||....|:....|....::|.|..::||:..|..:.  .::|...|:
plant   183 KPMYGLKTDYKVVNETEAKLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQ--YLMDTHTKR 245

  Fly   176 F----PNVDRWYKNAQKVT--PGW 193
            .    |:|.||   ..::|  |.|
plant   246 MFVNRPSVRRW---VAEITARPAW 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 25/74 (34%)
PLN02395 11..208 CDD:166036 54/207 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/130 (25%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 23/70 (33%)
GST_C_Phi 153..270 CDD:198296 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.