DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GSTF7

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:220 Identity:52/220 - (23%)
Similarity:91/220 - (41%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ::....|.:||.|::......::|..:.:....||..:..|:..||...:|...|..|.::|:||
plant     6 VFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRA 70

  Fly    68 IVVYLVEQYGKDD----SLYPKDPQKQAL---INQRLYFDMGT--LYDGIAKYFFPL--LRTGKP 121
            |..|:...|....    ||..||....|:   |....:..:|:  :::.:.|   ||  :.|.|.
plant    71 ITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLK---PLYGMTTDKT 132

  Fly   122 GTQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADI----VILATVSTTEMVDFDLKKFPNVDRW 182
            ..:|...||....|:..:.|....|:|.::.::.|:    ||...:.|.....||.:  |:|..|
plant   133 VVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPTKKLFDER--PHVSAW 195

  Fly   183 YKNAQKVTPGWDENLARIQSAKKFL 207
            .           .::....||||.|
plant   196 V-----------ADITSRPSAKKVL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/70 (26%)
PLN02395 11..208 CDD:166036 51/212 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/126 (20%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 18/70 (26%)
GST_C_Phi 95..209 CDD:198296 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.