DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GSTF4

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:226 Identity:45/226 - (19%)
Similarity:78/226 - (34%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YNMSGSP---STRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            |.:.|.|   :||.|:.......:.:..|.|....||.....|:.:||...:|...|....::|:
plant    37 YKVHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYES 101

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTL-------------------YDGIAKY 111
            |||..|:.         |....:...|:|.|.:..|.||                   ::.:.|.
plant   102 RAITQYIA---------YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKP 157

  Fly   112 FFPLLRTGKPGTQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKF 176
            .:. |.|.:...:||...|....::....|:...::|.|..::.                ||...
plant   158 IYG-LETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLV----------------DLHHL 205

  Fly   177 PNVD--------RWYKNAQKVTPGWDENLAR 199
            ||:.        :.::...||....||..:|
plant   206 PNIQYLLGTPTKKLFEKRSKVRKWVDEITSR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 20/72 (28%)
PLN02395 11..208 CDD:166036 42/216 (19%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/139 (17%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 19/70 (27%)
GST_C_Phi 126..243 CDD:198296 21/128 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.