DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Clic4

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:235 Identity:50/235 - (21%)
Similarity:85/235 - (36%) Gaps:78/235 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGS--------PSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQH------- 50
            ::|:..:||        |.::.:.|.....||.|:...|:           :|..|.|       
  Rat    19 IELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVD-----------LKRKPAHLQNLAPG 72

  Fly    51 TIPTLVD-NLFVIWETRAIVVYLVE-----QYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIA 109
            |.|..:. |..|..:...|..:|.|     :|.|   |.||.|:...           ...|..|
  Rat    73 THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLK---LSPKHPESNT-----------AGMDIFA 123

  Fly   110 KYFFPLLRTGKPGTQENLEK-----LNAAFDLLNNFLDGQ--------------DYVAGNQLSVA 155
            | |...::..:|...|.||:     |....:.||:.|.|:              .::.|:::::|
  Rat   124 K-FSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPGEIDENSMEDIKSSTRRFLDGDEMTLA 187

  Fly   156 DIVILATVSTTEMVDFDLKKFPNVD---------RWYKNA 186
            |..:|..:...::|   .||:.|.|         |:..||
  Rat   188 DCNLLPKLHIVKVV---AKKYRNFDIPKGMTGIWRYLTNA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/88 (20%)
PLN02395 11..208 CDD:166036 46/217 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/127 (20%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 19/92 (21%)
GST_N_CLIC 14..104 CDD:239359 19/95 (20%)
O-ClC 17..252 CDD:129941 50/235 (21%)
GST_C_family 111..251 CDD:295467 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.