DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GSTT3

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:206 Identity:61/206 - (29%)
Similarity:96/206 - (46%) Gaps:21/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRAIVVYLV 73
            |..:|||::..|...::|:.|.:.....:||.|.|..|||...:|.:||....:.|:.||::||.
plant    11 SQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSESHAILIYLS 75

  Fly    74 EQY-GKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFF-----PLLRTGKP----GTQENLE 128
            ..| ...|..||.|..|:|.|:..|.:....|..|.|.|..     |.|  |.|    ...|..:
plant    76 SAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPAL--GLPLNPKAAAEAEQ 138

  Fly   129 KLNAAFDLLNNF-LDGQD--YVAGNQLSVADIVILATVSTTEMVDFD-----LKKFPNVDRWYKN 185
            .|..:...|:.| |.|..  .:..||.|:||:.::..::..:::|..     |....||::|.:|
plant   139 LLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRLLSPHKNVEQWIEN 203

  Fly   186 AQKVT-PGWDE 195
            .:|.| |.:||
plant   204 TRKATMPHFDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/64 (34%)
PLN02395 11..208 CDD:166036 60/204 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/126 (27%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 55/192 (29%)
GST_N_Theta 3..78 CDD:239348 22/66 (33%)
GST_C_Theta 92..221 CDD:198292 34/125 (27%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.