DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GSTF12

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:208 Identity:46/208 - (22%)
Similarity:89/208 - (42%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ||....:...:.|::.....|:||..|.::....||.:|..:...|...:|.:.|..|.::|:||
plant     5 LYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKLFESRA 69

  Fly    68 IVVYLVEQYG-KDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLE--- 128
            |..|...::. :..:|..|..:.:|:::|  :.|:.|.|..:......:....||...|..:   
plant    70 IARYYATKFADQGTNLLGKSLEHRAIVDQ--WADVETYYFNVLAQPLVINLIIKPRLGEKCDVVL 132

  Fly   129 ------KLNAAFDLLNNFLDGQDYVAGNQLSVADIV-------ILATVSTTEMVDFDLKKFPNVD 180
                  ||....|:.||.|....::||.:.::||:.       :::.....:||    |...:.:
plant   133 VEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSITDINQMV----KARGSFN 193

  Fly   181 RWYKNAQKVTPGW 193
            ||::.... .|.|
plant   194 RWWEEISD-RPSW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/70 (27%)
PLN02395 11..208 CDD:166036 44/200 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/122 (20%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 46/208 (22%)
GST_N_Phi 2..77 CDD:239351 19/71 (27%)
GST_C_Phi 91..209 CDD:198296 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.