DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GSTF2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:204 Identity:45/204 - (22%)
Similarity:79/204 - (38%) Gaps:23/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ::....|.:||.|::......::|..:.|....||..:..|:..||...:|...|....::|:||
plant     6 VFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRA 70

  Fly    68 IVVYLVEQY-GKDDSLYPKDPQKQALINQRLYFDMGT-----LYDGIA-KYFFPL-------LRT 118
            |..|:..:| .:..:|...|.:.   |:|.....:|.     .:|.:| |..|..       |.|
plant    71 ITQYIAHRYENQGTNLLQTDSKN---ISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTT 132

  Fly   119 GKPGTQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKF----PNV 179
            .:....|...||....|:....|....|:||...::.|:..:..:.  .::....||.    |.|
plant   133 DEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQ--YLLGTPTKKLFTERPRV 195

  Fly   180 DRWYKNAQK 188
            :.|.....|
plant   196 NEWVAEITK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/70 (26%)
PLN02395 11..208 CDD:166036 44/196 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/118 (20%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 18/71 (25%)
GST_C_Phi 96..211 CDD:198296 23/111 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.