DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GSTF9

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:214 Identity:59/214 - (27%)
Similarity:96/214 - (44%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRAIVVYLV 73
            ||....|.:..|  ||.|.:|.|:...||..:|.::.:.|..|:|.:||..:.|:|:||::.|:.
plant    12 SPKRALVTLIEK--GVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVMRYVA 74

  Fly    74 EQY---GKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLR----------TGKPGTQ- 124
            |:|   |.|  |..|..:.:..:.|.|..:..|       |..|||.          .|.|..: 
plant    75 EKYRSQGPD--LLGKTVEDRGQVEQWLDVEATT-------YHPPLLNLTLHIMFASVMGFPSDEK 130

  Fly   125 ---ENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMV------DFDLKKFPNVD 180
               |:.|||....|:....|....|:||:.:|:||   ||.:..|:.:      .:.:|...:|.
plant   131 LIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLAD---LAHLPFTDYLVGPIGKAYMIKDRKHVS 192

  Fly   181 RWYKNAQKVTPGWDENLAR 199
            .|:.:... .|.|.|.:|:
plant   193 AWWDDISS-RPAWKETVAK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/64 (34%)
PLN02395 11..208 CDD:166036 57/212 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/132 (23%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 59/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.