DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Gstt4

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_083748.3 Gene:Gstt4 / 75886 MGIID:1923136 Length:240 Species:Mus musculus


Alignment Length:173 Identity:45/173 - (26%)
Similarity:83/173 - (47%) Gaps:17/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            ::||....|...|||.:.|:..|:.|:...|:...|......:::|||...:|:|.|..|::.|:
Mouse     3 LELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKLPSLKDGKFILSES 67

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFF-----PLLRTGKPGTQE 125
            .||:.||..:|......||.|...:|.:::.:.:....:...::|..:     |:: ||:....|
Mouse    68 VAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMI-TGEEVPTE 131

  Fly   126 NLEKLNAAFDLL--------NNFLDGQDYVAGNQLSVADIVIL 160
            .|||   ..|.:        ..||..:.::.|:.:|:||:|.|
Mouse   132 RLEK---TLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVAL 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 23/72 (32%)
PLN02395 11..208 CDD:166036 42/163 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 18/86 (21%)
Gstt4NP_083748.3 GstA 3..>170 CDD:223698 43/170 (25%)
GST_N_Theta 3..78 CDD:239348 23/74 (31%)