powered by:
Protein Alignment GstD6 and VARS1
DIOPT Version :9
Sequence 1: | NP_524915.1 |
Gene: | GstD6 / 48339 |
FlyBaseID: | FBgn0010042 |
Length: | 215 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005249419.1 |
Gene: | VARS1 / 7407 |
HGNCID: | 12651 |
Length: | 1265 |
Species: | Homo sapiens |
Alignment Length: | 75 |
Identity: | 23/75 - (30%) |
Similarity: | 31/75 - (41%) |
Gaps: | 11/75 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 LRTGKPGTQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFP--- 177
||:.....|..|..|..|...|..:|....|:||...::|| ||.| |..::.|.....|
Human 121 LRSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLAD---LAAV-TALLLPFRYVLDPPAR 181
Fly 178 ----NVDRWY 183
||.||:
Human 182 RIWNNVTRWF 191
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.