DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Clic3

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:188 Identity:41/188 - (21%)
Similarity:72/188 - (38%) Gaps:36/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRAIVVYLVE 74
            ||.:.:.|.....||.|....|:|.....:...|.   |...:|.|:.:..|..:|..|..:|.|
Mouse    55 PSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEE 116

  Fly    75 QYGKDD--SLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQEN--LEKLNAAFD 135
            ..|..|  ||.|:            |.:..|..:.|...|...::...| ||:|  .::|..|..
Mouse   117 TLGPPDFPSLAPR------------YRESNTAGNDIFHKFSAFIKNPVP-TQDNALYQQLLRALT 168

  Fly   136 LLNNFL----------------DGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFP 177
            .|:::|                ..:.::.|:|.::||..:|..:...:.|....::.|
Mouse   169 RLDSYLRAPLDHELAQEPHLRESHRRFLDGDQFTLADCSLLPKLHIVDTVCAHFRQLP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/63 (25%)
PLN02395 11..208 CDD:166036 40/187 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 19/108 (18%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 41/188 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.