Sequence 1: | NP_524915.1 | Gene: | GstD6 / 48339 | FlyBaseID: | FBgn0010042 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_687373.1 | Gene: | gdap1l1 / 562163 | ZFINID: | ZDB-GENE-080812-2 | Length: | 367 | Species: | Danio rerio |
Alignment Length: | 273 | Identity: | 51/273 - (18%) |
---|---|---|---|
Similarity: | 89/273 - (32%) | Gaps: | 102/273 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
Fly 68 IVVYLVEQYGKDD--SLYPKDPQKQALINQRLYFDMGT-LYDGIAKY-----------------F 112
Fly 113 FPLLRTG----KPGTQENLEKL-NAAFDLLN-----------------------------NFL-- 141
Fly 142 -----------------------DGQD---YVAGNQLSVADIVILATVSTTEMVDFDLKKF---- 176
Fly 177 -PNVDRWYKNAQK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD6 | NP_524915.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 17/70 (24%) |
PLN02395 | 11..208 | CDD:166036 | 48/265 (18%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 31/186 (17%) | ||
gdap1l1 | XP_687373.1 | GstA | 48..314 | CDD:223698 | 51/273 (19%) |
Thioredoxin_like | 48..120 | CDD:294274 | 17/69 (25%) | ||
GST_C_GDAP1L1 | 201..311 | CDD:198335 | 15/107 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589629 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |