DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gdap1l1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:273 Identity:51/273 - (18%)
Similarity:89/273 - (32%) Gaps:102/273 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ||:.:.|.|::.|.:.....|:......|:..:.||.||||:::|....:|..:....::.:...
Zfish    50 LYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDYNQ 114

  Fly    68 IVVYLVEQYGKDD--SLYPKDPQKQALINQRLYFDMGT-LYDGIAKY-----------------F 112
            |:.|:...:..|.  .|.|               |.|| :|..:.:|                 .
Zfish   115 IIDYIETNFVGDTVAQLIP---------------DEGTPMYARVQQYRELLDGLPMDAYTHGCIL 164

  Fly   113 FPLLRTG----KPGTQENLEKL-NAAFDLLN-----------------------------NFL-- 141
            .|.|.|.    |..|.|....| |||.:|:.                             |:|  
Zfish   165 HPELTTDSMIPKYATAEIRRHLANAASELMKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYLKK 229

  Fly   142 -----------------------DGQD---YVAGNQLSVADIVILATVSTTEMVDFDLKKF---- 176
                                   .||.   ::.|...::|||.:.||:...:.:....|.:    
Zfish   230 ILGELAMVLDQVEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRLKFLGLSRKYWEDGS 294

  Fly   177 -PNVDRWYKNAQK 188
             ||:..:::..||
Zfish   295 RPNLQSFFERVQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/70 (24%)
PLN02395 11..208 CDD:166036 48/265 (18%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/186 (17%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 51/273 (19%)
Thioredoxin_like 48..120 CDD:294274 17/69 (25%)
GST_C_GDAP1L1 201..311 CDD:198335 15/107 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.