DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and CLIC5

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001107558.1 Gene:CLIC5 / 53405 HGNCID:13517 Length:410 Species:Homo sapiens


Alignment Length:210 Identity:46/210 - (21%)
Similarity:81/210 - (38%) Gaps:75/210 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLYNMSGSPSTRAVMMTAKA-VGVEFNSIQVNTFVGEQLEP-WFVKINPQHTIPTLVDNLFVIWE 64
            ||:|:  :|.|....:|... |..:.|.|:  .|:.|.|.| .:.|:..:|.            |
Human   221 DLHNL--APGTHPPFLTFNGDVKTDVNKIE--EFLEETLTPEKYPKLAAKHR------------E 269

  Fly    65 TRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEK 129
            :....:.:..::    |.|.|:.::|         :...|..|:.|               .|:|
Human   270 SNTAGIDIFSKF----SAYIKNTKQQ---------NNAALERGLTK---------------ALKK 306

  Fly   130 LNAAFDLLNNFLD--------GQD------YVAGNQLSVADIVILATVSTTEMVDFDLKKFPNVD 180
            |:   |.||..|.        |:|      ::.|::|::||..:|..:...::|   .||:.|.|
Human   307 LD---DYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIV---AKKYRNYD 365

  Fly   181 ---------RWYKNA 186
                     |:.|||
Human   366 IPAEMTGLWRYLKNA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/73 (22%)
PLN02395 11..208 CDD:166036 42/201 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/122 (22%)
CLIC5NP_001107558.1 O-ClC 173..408 CDD:129941 46/210 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.