DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Gstt3

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:213 Identity:62/213 - (29%)
Similarity:96/213 - (45%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            ::||....|...|||.:.||..|:.|....:....|:.....|.::||...:|.|.|..||:.|:
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAES 124

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIA-----KYFFPLLRTGKPGTQE 125
            .||::||..:|...|..||:|.|.:|.:::.|.:....|....:     |..||:. .|:|...|
  Rat   125 VAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVF-LGQPVPPE 188

  Fly   126 NLEKLNAAFD-----LLNNFLDGQDYVAGNQLSVADIVILATVSTTEM---VDFDLKKF---PNV 179
            .|....|..|     |.:.||..:.::.|..:||||:|.:     ||:   |....|.|   |.:
  Rat   189 RLASTLAELDGCLQMLEDKFLQNKAFLTGPHISVADLVAI-----TELMHPVSAGCKIFESRPKL 248

  Fly   180 DRWYKNAQKVTPGWDENL 197
            ..|   .|:|.....|:|
  Rat   249 AAW---RQRVEAAVGESL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 24/72 (33%)
PLN02395 11..208 CDD:166036 59/203 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/126 (26%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 24/74 (32%)
GST_C_Theta 149..273 CDD:198292 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348118
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.