DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:229 Identity:61/229 - (26%)
Similarity:103/229 - (44%) Gaps:38/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SPSTRAVMMTAKAVGVEFNSIQVNTF-VGEQLEPWFVKINPQHTIPTLVDNLFVIWETRAIVVYL 72
            |...|:|.:.|||..:.||..::... .||.|...|.|::..|.:|.|.|..|.:.|:.|:::||
 Frog    14 SQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFTMAESTAMLLYL 78

  Fly    73 VEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFF-----PLLRTGKPGTQENLEKLNA 132
            ..:|...:..||.|.||:|.:::.|.:.........:|.|:     |.: .||....|.:..:.|
 Frog    79 ARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTI-LGKEVPSEKMNAVMA 142

  Fly   133 AF-DLLNN----FLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKF---PNVDRWYK----- 184
            .| ..:||    ||..:.::||:::||||:|  |.|...:::...:..|   |.:..|.:     
 Frog   143 EFVTTMNNFEEKFLGNKPFIAGDEISVADLV--AIVEIMQVIASGVNVFEERPKLGSWKQRLVEA 205

  Fly   185 ----------------NAQKVTPGWDENLARIQS 202
                            :.||..|...|.|.|::|
 Frog   206 VGEELFLEAHEWILSFSKQKFDPPPPELLQRLRS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/65 (34%)
PLN02395 11..208 CDD:166036 60/227 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 35/149 (23%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 22/67 (33%)
GST_C_Theta 95..221 CDD:198292 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.