DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and clic5a

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:230 Identity:53/230 - (23%)
Similarity:88/230 - (38%) Gaps:68/230 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGS--------PSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQ--HTI--- 52
            ::|:..:||        |.::.:.|.....||.||...|:           :|..|.  |.:   
Zfish    12 IELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVD-----------LKRKPADLHNLAPG 65

  Fly    53 ---PTLVDNLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFP 114
               |.|..|..|..:...|..:|.|....     ||.| |.|..|:    :..|..:.|...|..
Zfish    66 TPPPFLTFNGEVRTDVNKIEEFLEEMLAP-----PKYP-KLAAKNK----ESNTAGNDIFAKFSA 120

  Fly   115 LLRTGKPGTQENLEK-LNAAFDLLNNFLD------------GQD------YVAGNQLSVADIVIL 160
            .::..||....:||| |......|::||:            |::      |:.||:|::||..:|
Zfish   121 YIKNTKPEANASLEKGLLKVLKKLDSFLNSPLPDEIDAESTGEEKSSNRKYLDGNELTLADCNLL 185

  Fly   161 ATVSTTEMVDFDLKKFPNVD---------RWYKNA 186
            ..:...::|.   ||:.|.:         |:.:||
Zfish   186 PKLHVVKVVS---KKYRNFEIPSDLSGVWRYLQNA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/88 (22%)
PLN02395 11..208 CDD:166036 49/212 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/127 (24%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 21/100 (21%)
O-ClC 10..244 CDD:129941 53/230 (23%)
GST_C_CLIC5 104..244 CDD:198330 28/121 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.