DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstD8

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:209 Identity:115/209 - (55%)
Similarity:157/209 - (75%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            ||.|....|...|:|:|||||:||:.|...:....||||:|.|||:||||.||||||:.|.|||:
  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWES 65

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEKL 130
            |||::||||:||.||||||.||||:|::|||||||||||:....:..:|.:|...|...|.::|:
  Fly    66 RAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQKV 130

  Fly   131 NAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFPNVDRWYKNAQKVTPGWDE 195
            ::||..|:.||:.|:||||:.|::|||.:||:|||.|:||||:.::|||.|||:||::|||||:|
  Fly   131 DSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEVTPGWEE 195

  Fly   196 NLARIQSAKKFLAE 209
            |...:|..||.:.|
  Fly   196 NWDGVQLIKKLVQE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 41/72 (57%)
PLN02395 11..208 CDD:166036 110/196 (56%)
GST_C_Delta_Epsilon 88..204 CDD:198287 59/115 (51%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 104/186 (56%)
GST_N_Delta_Epsilon 1..74 CDD:239343 41/72 (57%)
GST_C_Delta_Epsilon 88..204 CDD:198287 59/115 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468490
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.