DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstD3

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:193 Identity:114/193 - (59%)
Similarity:147/193 - (76%) Gaps:0/193 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRAIVVYLVEQYGKDDS 81
            |..||:|:|||...:||..|||:.|.|:||||||:|||||||.|.|||:|||:|||||:|||||:
  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA 65

  Fly    82 LYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEKLNAAFDLLNNFLDGQDY 146
            |||||.||||:|||||||||..:|..:|.|::....||:.|::|:.:|:...||.||.||:||||
  Fly    66 LYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQDY 130

  Fly   147 VAGNQLSVADIVILATVSTTEMVDFDLKKFPNVDRWYKNAQKVTPGWDENLARIQSAKKFLAE 209
            |||:|.:||||.|||.||..::|.||:.|:|||.|||.:.:|:||||:||.|.....||.:.|
  Fly   131 VAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRIEE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 37/56 (66%)
PLN02395 11..208 CDD:166036 113/190 (59%)
GST_C_Delta_Epsilon 88..204 CDD:198287 62/115 (54%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 37/56 (66%)
GstA 6..173 CDD:223698 100/166 (60%)
GST_C_Delta_Epsilon 72..188 CDD:198287 62/115 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468494
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.