DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstD2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:215 Identity:133/215 - (61%)
Similarity:164/215 - (76%) Gaps:1/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            ||.|.|.|....|.|:|.|||:|:|.|...:||..||||:|.|||:||||||||||||.|.|||:
  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEKL 130
            |||.|||||:|||||.|.|.||:|:|:|||||||||||||:..|||::||.||||||:.|:|:::
  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYPLFRTGKPGSDEDLKRI 130

  Fly   131 NAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFPNVDRWYKNAQKVTPGWDE 195
            ..||..|:.||:||:||||:||:||||.||:||||.|:.:||..|:.||.|||.||:||||||||
  Fly   131 ETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGWDE 195

  Fly   196 NLARIQSAKK-FLAENLIEK 214
            |...:.:.|. |.|..|..|
  Fly   196 NWEGLMAMKALFDARKLAAK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 46/72 (64%)
PLN02395 11..208 CDD:166036 125/197 (63%)
GST_C_Delta_Epsilon 88..204 CDD:198287 71/115 (62%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 46/72 (64%)
GST_C_Delta_Epsilon 88..204 CDD:198287 71/115 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468489
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.