DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and clic2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:203 Identity:45/203 - (22%)
Similarity:81/203 - (39%) Gaps:36/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVK-INPQHTIPTLVDNLFVIWETRAI 68
            |:...|..:.:.|.....||:|..    |.|..:.:|..:| :.|....|.|:.|     .|...
Zfish    25 NVGNCPFCQRLFMVLWLKGVKFTV----TTVDMRKKPDELKDLAPGTNPPFLLYN-----GTLKT 80

  Fly    69 VVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEKLNAA 133
            ....:|::.:.....|:.|.......:.  ||:|.  |..||  |.......|....:.:.|...
Zfish    81 DFIKIEEFLETTLAPPRYPHLSPRYKES--FDVGA--DIFAK--FSAFIKNSPNNAFHEKALLRE 139

  Fly   134 FDLLNNFLDG--QD------------YVAGNQLSVADIVIL-----ATVSTTEMVDFDL-KKFPN 178
            |..|:::|:.  ||            ::.||:|::||..:|     ..|:..:..:||: .:|..
Zfish   140 FKRLDDYLNTPLQDELDQNISVSKRKFLDGNRLTLADCNLLPKLHVIKVAARKYCNFDIPTQFTG 204

  Fly   179 VDRWYKNA 186
            |.|:.::|
Zfish   205 VWRYLQSA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 15/69 (22%)
PLN02395 11..208 CDD:166036 43/197 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/119 (23%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 45/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.