DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gfzf

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:214 Identity:72/214 - (33%)
Similarity:114/214 - (53%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            |.||.:|..|.:.||.||.||:.:::..|.|:....|.....:.|:|||..||.|.|:.|.:.|:
  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLY-----DGIAKYFFPLLRTGKPGTQE 125
            .||:.||.::|..|.:|||:|...:|:|||||.|:||..|     ..:|..||...|     |..
  Fly   877 IAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKR-----TPM 936

  Fly   126 NLEKLNAAFDLLNNFLD--GQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFPNVDRWYKNAQK 188
            :|:|:..|.|:...:|.  |..|.||..:::||..:::.....|.::|||.:|..|::||:..:.
  Fly   937 SLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYETFKV 1001

  Fly   189 VTPG-WDENLARIQSAKKF 206
            ..|. |:...:.:|....|
  Fly  1002 EYPQLWEIANSGMQEISAF 1020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 28/72 (39%)
PLN02395 11..208 CDD:166036 67/204 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 37/123 (30%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 28/73 (38%)
GstA 812..1000 CDD:223698 68/192 (35%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 37/121 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.920

Return to query results.
Submit another query.