DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Clic1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001002807.1 Gene:Clic1 / 406864 RGDID:1303043 Length:241 Species:Rattus norvegicus


Alignment Length:219 Identity:50/219 - (22%)
Similarity:87/219 - (39%) Gaps:46/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGS--------PSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVD 57
            ::|:..:||        |.::.:.|.....||.||...|:|   ::......|:.|...:|.|:.
  Rat     8 VELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDT---KRRTETVQKLCPGGQLPFLLY 69

  Fly    58 NLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPG 122
            ...|..:|..|..:|      :..|.|....|.|.:|.    :..|....|...|...::...|.
  Rat    70 GTEVHTDTNKIEEFL------EAVLCPPRYPKLAALNP----ESNTSGLDIFAKFSAYIKNSNPA 124

  Fly   123 TQENLEK-LNAAFDLLNNFLDG------------------QDYVAGNQLSVADIVILATVSTTEM 168
            ..:|||| |..|..:|:|:|..                  :.::.||:|::||..:|..:...::
  Rat   125 LNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGISQRKFLDGNELTLADCNLLPKLHIVQV 189

  Fly   169 V-----DFDL-KKFPNVDRWYKNA 186
            |     .|.: :.|..|.|:..||
  Rat   190 VCKKYRGFTIPEAFRGVHRYLSNA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/80 (24%)
PLN02395 11..208 CDD:166036 46/201 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/124 (23%)
Clic1NP_001002807.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 20/90 (22%)
O-ClC 6..241 CDD:129941 50/219 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.