Sequence 1: | NP_524915.1 | Gene: | GstD6 / 48339 | FlyBaseID: | FBgn0010042 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998062.1 | Gene: | clic5b / 405833 | ZFINID: | ZDB-GENE-040426-2542 | Length: | 408 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 44/203 - (21%) |
---|---|---|---|
Similarity: | 73/203 - (35%) | Gaps: | 51/203 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 NMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQ--HTI------PTLVDNLFV 61
Fly 62 IWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQEN 126
Fly 127 LEK-LNAAFDLLNNFLD------------------GQDYVAGNQLSVADIVILATVSTTEMVDFD 172
Fly 173 LKKFPNVD 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD6 | NP_524915.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 16/76 (21%) |
PLN02395 | 11..208 | CDD:166036 | 43/197 (22%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 24/112 (21%) | ||
clic5b | NP_998062.1 | GST_N_CLIC | 170..259 | CDD:239359 | 18/88 (20%) |
O-ClC | 172..407 | CDD:129941 | 44/203 (22%) | ||
GST_C_CLIC5 | 266..406 | CDD:198330 | 23/102 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589657 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |