DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and clic5b

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:203 Identity:44/203 - (21%)
Similarity:73/203 - (35%) Gaps:51/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQ--HTI------PTLVDNLFV 61
            ::...|.::.:.|.....||.||...|:           :|..|.  |.:      |.|..|..|
Zfish   186 SIGNCPFSQRLFMILWLKGVVFNVTTVD-----------LKRKPADLHNLAPGTHPPFLTFNGEV 239

  Fly    62 IWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQEN 126
            ..:...|..:|.|....     ||.|:..|     .:.:.....:.|...|...::..||...|.
Zfish   240 KTDVNKIEEFLEEVLAP-----PKYPKLAA-----RHRESNAAGNDIFAKFSAFIKNTKPDANEA 294

  Fly   127 LEK-LNAAFDLLNNFLD------------------GQDYVAGNQLSVADIVILATVSTTEMVDFD 172
            ||| |..|...|:.:|:                  .:.::.||.|::||..:|..:...::|   
Zfish   295 LEKGLTKALKKLDEYLNSPLPDEVDADSMEEEKASNRRFLDGNDLTLADCNLLPKLHIVKVV--- 356

  Fly   173 LKKFPNVD 180
            .||:.|.|
Zfish   357 AKKYRNFD 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/76 (21%)
PLN02395 11..208 CDD:166036 43/197 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/112 (21%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 18/88 (20%)
O-ClC 172..407 CDD:129941 44/203 (22%)
GST_C_CLIC5 266..406 CDD:198330 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.