DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gstt1b

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:208 Identity:60/208 - (28%)
Similarity:105/208 - (50%) Gaps:18/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            :||:    |...|:|.:.||...::|:..:::.|.|.|....|.||||....||:.|..|.:.|:
Zfish     7 LDLF----SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAES 67

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTL-YDGIAKYFFPLLRTGKPGTQ----- 124
            .||::||.:::...|..:|.|.||:|.:|:.|.:...:: ..|....:|.:|.....|.:     
Zfish    68 VAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKEK 132

  Fly   125 -ENLEK-LNAAFDLL-NNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDL-KKFPNVDRWYKN 185
             ||.|: ||.|..|. :.||..:.::.|:|:|:||:|.:..:........|: :..|.:..| |:
Zfish   133 MENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENRPKLKAW-KD 196

  Fly   186 AQKVTPG---WDE 195
            ..:|..|   :||
Zfish   197 RVRVAIGAKLFDE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 25/72 (35%)
PLN02395 11..208 CDD:166036 57/198 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/121 (26%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 56/196 (29%)
GST_N_Theta 3..78 CDD:239348 25/74 (34%)
GST_C_Theta 91..217 CDD:198292 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.