Sequence 1: | NP_524915.1 | Gene: | GstD6 / 48339 | FlyBaseID: | FBgn0010042 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956878.1 | Gene: | gstt1b / 393556 | ZFINID: | ZDB-GENE-040426-1491 | Length: | 242 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 60/208 - (28%) |
---|---|---|---|
Similarity: | 105/208 - (50%) | Gaps: | 18/208 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
Fly 66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTL-YDGIAKYFFPLLRTGKPGTQ----- 124
Fly 125 -ENLEK-LNAAFDLL-NNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDL-KKFPNVDRWYKN 185
Fly 186 AQKVTPG---WDE 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD6 | NP_524915.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 25/72 (35%) |
PLN02395 | 11..208 | CDD:166036 | 57/198 (29%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 32/121 (26%) | ||
gstt1b | NP_956878.1 | GstA | 1..199 | CDD:223698 | 56/196 (29%) |
GST_N_Theta | 3..78 | CDD:239348 | 25/74 (34%) | ||
GST_C_Theta | 91..217 | CDD:198292 | 31/120 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100130 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.720 |