DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gstt2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:199 Identity:62/199 - (31%)
Similarity:95/199 - (47%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRAIVVYLV 73
            |...|||::..|...:.....|:....|||..|.|.|:||...:|.|.||.||:.|:.||:.||.
Zfish    15 SQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYLA 79

  Fly    74 EQYGKDDSLYPKDPQKQALINQ-RLYFDMGTLYDGIAKYF----FPLLRTGKPGTQENLEK---- 129
            ..|...|..|||.|:|:|.::: ..:..|.|.......::    .||: ||:|.....|||    
Zfish    80 TTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLPLM-TGQPANTAKLEKALSD 143

  Fly   130 LNAAFDLLNN-FLDGQDYVAGNQLSVADIVILATVSTTEMVDFD-LKKFPNVDRWYKNAQK-VTP 191
            |:...|.|.| ||..|.::.|:.:|:||::.:..:........| ||..|.:..|....|. ::.
Zfish   144 LSGTLDKLENMFLKRQAFLCGDDISLADLLAICELMQPMSSGRDILKDRPKLLSWRSRVQSALSD 208

  Fly   192 GWDE 195
            .:||
Zfish   209 SFDE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 25/64 (39%)
PLN02395 11..208 CDD:166036 61/197 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/120 (26%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 25/66 (38%)
GST_C_Theta 95..220 CDD:198292 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589533
Domainoid 1 1.000 50 1.000 Domainoid score I11638
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.