DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstO2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:203 Identity:48/203 - (23%)
Similarity:85/203 - (41%) Gaps:43/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTL----VDNLFVIWE 64
            ::|:..|.:..|.:...|..:|.:.|.|:..  |:.| |:...:|...:|.|    |.:...:.|
  Fly    26 FSMAFCPFSHRVRLMLAAKHIEHHKIYVDLI--EKPE-WYKDFSPLGKVPALQLTGVKDQPTLVE 87

  Fly    65 TRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEK 129
            :..|..||.:|| ....|:|.||.::||  .::..:.   :..:....:|:| |..|        
  Fly    88 SLIIAEYLDQQY-PQTRLFPTDPLQKAL--DKILIER---FAPVVSAIYPVL-TCNP-------- 137

  Fly   130 LNAAFDLLNNF---LD---------GQDYVAGNQLSVADIVI--------LATVSTTEMVDFDLK 174
             ||..|.:.||   ||         |..|.||..:.:.|.:|        ...::|.:..:.|.|
  Fly   138 -NAPKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTK 201

  Fly   175 KFPNVDRW 182
            :|..:.:|
  Fly   202 RFEKLLKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/73 (25%)
PLN02395 11..208 CDD:166036 46/196 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/115 (21%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 17/72 (24%)
GstA 25..215 CDD:223698 48/203 (24%)
GST_C_Omega 110..235 CDD:198293 24/115 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.