DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and se

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:203 Identity:49/203 - (24%)
Similarity:85/203 - (41%) Gaps:35/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTL----VDNLFVIW 63
            ||:|...|..:.|.:...|..:.::||.:|  :.::.| |.::.|||..:|.|    .....|:.
  Fly    24 LYSMRFCPFAQRVHLVLDAKQIPYHSIYIN--LTDKPE-WLLEKNPQGKVPALEIVREPGPPVLT 85

  Fly    64 ETRAIVVYLVEQYGKDDSLYPKDPQKQA---LINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQE 125
            |:..|..||.|||.. ..|||:||.|:.   |:.:|....:|..:              |.....
  Fly    86 ESLLICEYLDEQYPL-RPLYPRDPLKKVQDKLLIERFRAVLGAFF--------------KASDGG 135

  Fly   126 NLEKLNAAFDLLNNFL--DGQDYVAGNQLSVADIVI--------LATVSTTEMVDFDLKKFPNVD 180
            :||...:..|:....|  .|.::..|.|..:.|.:|        |..:...|..::|..:||.:.
  Fly   136 DLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLT 200

  Fly   181 RWYKNAQK 188
            .|.:..::
  Fly   201 LWLERMKR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 21/74 (28%)
PLN02395 11..208 CDD:166036 45/195 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/114 (18%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 20/73 (27%)
GstA 22..215 CDD:223698 49/203 (24%)
GST_C_Omega 109..229 CDD:198293 20/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.