DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstO3

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:204 Identity:48/204 - (23%)
Similarity:84/204 - (41%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTI-----------PTLV 56
            ||:|...|..:...:...|..|.::|:.:|  :.|:.| |.|:::|...:           |:|:
  Fly    24 LYSMRFCPYAQRAHLVLNAKNVPYHSVYIN--LTEKPE-WLVEVSPLLKVPALQLVAEKGEPSLI 85

  Fly    57 DNLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQA---LINQRLYFDMGTLYDGIAKYFFPLLRT 118
            ::|.       |..||.::| .::.|.||||.|:|   ::.:|        :..|...|..:|..
  Fly    86 ESLI-------IAEYLDDKY-PENPLLPKDPLKRAQDKILLER--------FSSITSAFINILVQ 134

  Fly   119 GKPGTQENLEKLNAAFDLLNNFLD--GQDYVAGNQLSVADIVILATVSTTEMVDFDLKK------ 175
            |     ..||....|.|:....|.  |..|..||:....|.:|........:::..|:|      
  Fly   135 G-----TGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNE 194

  Fly   176 --FPNVDRW 182
              ||.:.:|
  Fly   195 SRFPKITKW 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/81 (23%)
PLN02395 11..208 CDD:166036 44/196 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/108 (21%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 18/80 (23%)
GstA 22..209 CDD:223698 48/204 (24%)
GST_C_Omega 109..230 CDD:198293 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.