DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstE11

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:198 Identity:74/198 - (37%)
Similarity:114/198 - (57%) Gaps:5/198 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ||....||..|||::||.|:|:|.:...||...||.....|:|:|.|||||.|.||..::.::..
  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71

  Fly    68 IVVYLVEQYGK--DDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGT-QENLEK 129
            |..||.::|..  |||||||||:|:.|::.|||:|.|.|:..|.....|::..|.... .:.:..
  Fly    72 ICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDRVAY 136

  Fly   130 LNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTE-MVDFDLKKFPNVDRWYKNAQKVTPGW 193
            |..|:|.|.:.|...||:.|::|::||:..:|:|||.| ....:..:||.:.:|.|..|.: |.:
  Fly   137 LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQAL-PYY 200

  Fly   194 DEN 196
            .:|
  Fly   201 QKN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 30/70 (43%)
PLN02395 11..208 CDD:166036 70/190 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 34/111 (31%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 72/191 (38%)
GST_N_Delta_Epsilon 5..78 CDD:239343 30/70 (43%)
GST_C_Delta_Epsilon 94..211 CDD:198287 34/111 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460326
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.