DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstE8

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:215 Identity:75/215 - (34%)
Similarity:126/215 - (58%) Gaps:15/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ||....||..||..:|..|:|:.:..:::||...|.|.|.|::.|||||:|||.|:...||::.|
  Fly     6 LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHA 70

  Fly    68 IVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLY----DGIAKYFFPLLRTGKPG-TQENL 127
            |..|||.:||:.|:|||||..::|:::|||:|:.|.::    .||.|   ||..||:.. .:|..
  Fly    71 ISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITK---PLFATGQTTIPKERY 132

  Fly   128 EKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEM-VDFDLKKFPNVDRWYKNAQKVTP 191
            :.:...:|.:..||.|.|::||:||::||..::.:::...: |..|..|:.|:..|.|..::: |
  Fly   133 DAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL-P 196

  Fly   192 GWDENLAR-----IQSAKKF 206
            .::|...:     :...|||
  Fly   197 YYEEACGKGARDLVTLLKKF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 30/70 (43%)
PLN02395 11..208 CDD:166036 71/207 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/126 (26%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 70/193 (36%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/70 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460315
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.