DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstE7

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:215 Identity:89/215 - (41%)
Similarity:131/215 - (60%) Gaps:13/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ||.:..||..|||.:|..|:.|.:..::|||...|.....|:|.|||||:|||.|:...||::.|
  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYIWDSHA 70

  Fly    68 IVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLY----DGIAKYFFPLLRTGKPGTQENLE 128
            |:.|||.:|||.|||||||..::|:::|||:|:.|.::    ..|.|..|...:|..|  :|..:
  Fly    71 IIAYLVSKYGKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIP--KERYD 133

  Fly   129 KLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEM-VDFDLKKFPNVDRWYKNAQKVTPG 192
            .:...:|.|..||.|.||||||||::||..|::|||:.|: |..|..|:|.:..|:|..||: |.
  Fly   134 AIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRLQKL-PY 197

  Fly   193 WDE---NLARIQSAKKFLAE 209
            ::|   |.||  :.:.|:.|
  Fly   198 YEEANGNGAR--TFESFIRE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 31/70 (44%)
PLN02395 11..208 CDD:166036 84/204 (41%)
GST_C_Delta_Epsilon 88..204 CDD:198287 45/123 (37%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 82/192 (43%)
GST_N_Delta_Epsilon 4..77 CDD:239343 31/70 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 45/122 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460321
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.