DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstE4

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:210 Identity:72/210 - (34%)
Similarity:127/210 - (60%) Gaps:6/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65
            :.||.:..||.|||.::|.||:.:.|..:.||.|..|.....|.|.|||||:|.|.|:...||::
  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDS 68

  Fly    66 RAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYD-GIAKYFFPLLRTGKPGTQEN-LE 128
            .||:.||||:|...|.|||||..::|.::|.::|:.|.::: .:.:...|:|..|:|....| ::
  Fly    69 HAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQVD 133

  Fly   129 KLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEM-VDFDLKKFPNVDRWYKNAQKVTPG 192
            .:...:|.:..|||..|:|||:||::||..|::|:::..: ::.|..|:|.:..|.:..::: |.
  Fly   134 HILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL-PY 197

  Fly   193 WDENLARIQSAKKFL 207
            ::|  |..:.|.:|:
  Fly   198 YEE--ANGKGAAQFV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 31/72 (43%)
PLN02395 11..208 CDD:166036 68/200 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/118 (25%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 31/72 (43%)
GstA 6..196 CDD:223698 67/190 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/120 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460316
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.