DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstE1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:208 Identity:83/208 - (39%)
Similarity:111/208 - (53%) Gaps:4/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ||....||..|.|.:|.|.:.:::...:||...||.|...:||.|||||:|.|.||...||::.|
  Fly     8 LYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHA 72

  Fly    68 IVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGT-QENLEKLN 131
            |..|||::|.|.|.|||||..|:|::||||:||...:|..||....|....|.... ||.|:.::
  Fly    73 IAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVH 137

  Fly   132 AAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTT-EMVDFDLKKFPNVDRWYKNAQKVTPGWDE 195
            ....||..||....|:||:.|::||:....|||.. ..||.|...:|.|..|.....|: |.:.|
  Fly   138 QGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKL-PYYKE 201

  Fly   196 -NLARIQSAKKFL 207
             |.|..||...||
  Fly   202 INEAPAQSYVAFL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 30/70 (43%)
PLN02395 11..208 CDD:166036 79/200 (40%)
GST_C_Delta_Epsilon 88..204 CDD:198287 42/118 (36%)
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 30/70 (43%)
GstA 8..197 CDD:223698 75/189 (40%)
GST_C_Delta_Epsilon 94..210 CDD:198287 41/116 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460323
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.