DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and clic4

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:239 Identity:49/239 - (20%)
Similarity:84/239 - (35%) Gaps:82/239 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGS--------PSTRAVMMTAKAVGVEFNSIQV----------NTFVGEQLEPWFVKIN 47
            ::|:..:||        |.::.:.|.....||.||...|          |...|  ..|.|:..|
Zfish    18 IELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLQNLAPG--THPPFITFN 80

  Fly    48 PQHTIPTLVDNLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLY------- 105
            .:  :.|.|:.              :|:|.:|....||            |..:|..:       
Zfish    81 GE--VKTDVNK--------------IEEYLEDILCPPK------------YSKLGARHPESNTAG 117

  Fly   106 -DGIAKYFFPLLRTGKPGTQENLEK-LNAAFDLLNNFL-----DGQD-------------YVAGN 150
             |..|| |...::..||...|.||: |......|:.:|     |..|             ::.|.
Zfish   118 MDIFAK-FSAFIKNSKPDANEALERGLLKTLQKLDEYLCSPLPDEIDHNSMEEVKASTRMFLDGE 181

  Fly   151 QLSVADIVILATVSTTEMV-----DFDL-KKFPNVDRWYKNAQK 188
            ::::||..:|..:...::|     .|:: |....:.|:..||.|
Zfish   182 EMTLADCNLLPKLHIVKVVAKKYRGFEIPKDLTGIWRYLNNAYK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/90 (19%)
PLN02395 11..208 CDD:166036 45/221 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/134 (20%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359 22/114 (19%)
O-ClC 16..250 CDD:129941 49/239 (21%)
GST_C_CLIC4 110..250 CDD:198329 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.