DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and clic1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:210 Identity:45/210 - (21%)
Similarity:81/210 - (38%) Gaps:54/210 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGS--------PSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVK-INPQHTIPTLV 56
            ::|:..:||        |.::.:.|.....||.||.    |.|..:.:|..:| :.|....|.|:
Zfish     8 VELFVKAGSDGQSIGNCPFSQRLFMVLWLKGVTFNV----TTVDMKRKPEILKDLAPGAQPPFLL 68

  Fly    57 DNLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKP 121
            ....|..:|..|..:|      :::|.|....:.|..|.    :..|....:...|...::...|
Zfish    69 YGTEVKTDTNKIEEFL------EETLCPPKYPRLAACNP----ESNTAGLDVFSKFSAYIKNSNP 123

  Fly   122 GTQENLEK----------------------LNAAFDLLN---NFLDGQDYVAGNQLSVADIVILA 161
            ...:||||                      .|:|.|:::   :|||||      :|::||..:|.
Zfish   124 QMNDNLEKGLLKALKKLDDYLSSPLPDEIDENSADDVISSTRSFLDGQ------ELTLADCNLLP 182

  Fly   162 TVSTTEMVDFDLKKF 176
            .:...::|....:.|
Zfish   183 KLHIVKVVCLKFRGF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 20/81 (25%)
PLN02395 11..208 CDD:166036 41/192 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/114 (20%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 22/94 (23%)
O-ClC 6..241 CDD:129941 45/210 (21%)
GST_C_CLIC1 100..238 CDD:198333 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.