DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstT4

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:213 Identity:46/213 - (21%)
Similarity:97/213 - (45%) Gaps:24/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 STRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWF-VKINPQHTIPTLVDNLFVIWETRAIVVYLVE 74
            |:||:.:..:|..:.|.:|.::...||.|...| ..:|....:|.:.|:.:.:.|..||..:|..
  Fly    15 SSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAR 79

  Fly    75 QYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIA-------KYFFPLLRTGKPG------TQEN 126
            :....:..||:....::.|::.|.:....:  |:|       |:..|.|:..:|.      ..:.
  Fly    80 EKLVPEHWYPRRHLGRSRIDEYLAWQQTNM--GVATTEYFQQKWLVPYLQKTRPADNAVNLASKQ 142

  Fly   127 LEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFPN---VDRWYKNA-Q 187
            ||.....|:.|  ||:.:.::.|:.:|.||:..:..:...:.:.::  .|.|   :.|||:.. :
  Fly   143 LEHTLNEFEQL--FLNSRKFMMGDNISYADLSAICEIDQPKSIGYN--AFQNRNKLARWYETVRE 203

  Fly   188 KVTPGWDENLARIQSAKK 205
            ::.|.:.|.|...::..|
  Fly   204 ELGPHYKEVLGEFEAKLK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/63 (27%)
PLN02395 11..208 CDD:166036 46/213 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/132 (20%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 17/64 (27%)
GST_C_Theta 95..220 CDD:198292 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459977
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.