Sequence 1: | NP_524915.1 | Gene: | GstD6 / 48339 | FlyBaseID: | FBgn0010042 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101367.1 | Gene: | Gdap1 / 312890 | RGDID: | 1309005 | Length: | 358 | Species: | Rattus norvegicus |
Alignment Length: | 263 | Identity: | 47/263 - (17%) |
---|---|---|---|
Similarity: | 86/263 - (32%) | Gaps: | 82/263 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
Fly 68 IVVYLVEQY----------GKDDSLYPK----------------------------DPQKQALIN 94
Fly 95 QRLYFDMGTLYDGIAKYFFPLLRTGKPGTQE-----------------NLEKLNAAFDLLNNFLD 142
Fly 143 -----------------GQDYVAGNQLSVADIVILATVSTTEMVDFDLK-----KFPNVDRWYKN 185
Fly 186 AQK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD6 | NP_524915.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 19/70 (27%) |
PLN02395 | 11..208 | CDD:166036 | 44/255 (17%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 25/140 (18%) | ||
Gdap1 | NP_001101367.1 | GstA | 26..292 | CDD:223698 | 47/263 (18%) |
GST_N_GDAP1 | 26..98 | CDD:239350 | 18/69 (26%) | ||
GST_C_GDAP1 | 179..289 | CDD:198336 | 20/107 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348238 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |