DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Gdap1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001101367.1 Gene:Gdap1 / 312890 RGDID:1309005 Length:358 Species:Rattus norvegicus


Alignment Length:263 Identity:47/263 - (17%)
Similarity:86/263 - (32%) Gaps:82/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            ||:.:.|.|::.|.:......::.....|:..:.|..||||:::|....:|.|:....:|.|...
  Rat    28 LYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQ 92

  Fly    68 IVVYLVEQY----------GKDDSLYPK----------------------------DPQKQALIN 94
            |:.||.:.:          .:....||:                            |....|...
  Rat    93 IIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYAT 157

  Fly    95 QRLYFDMGTLYDGIAKYFFPLLRTGKPGTQE-----------------NLEKLNAAFDLLNNFLD 142
            .|:...:|.....:.|     |....|..||                 |::.|....|.|...||
  Rat   158 TRIRGQIGNTESELKK-----LAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLD 217

  Fly   143 -----------------GQDYVAGNQLSVADIVILATVSTTEMVDFDLK-----KFPNVDRWYKN 185
                             .|.::.|...::||:.:..|:...:.:.|..:     |.||::.:|:.
  Rat   218 QVETELQRRNEETPDEGNQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGHGKRPNLESYYER 282

  Fly   186 AQK 188
            ..|
  Rat   283 VLK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/70 (27%)
PLN02395 11..208 CDD:166036 44/255 (17%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/140 (18%)
Gdap1NP_001101367.1 GstA 26..292 CDD:223698 47/263 (18%)
GST_N_GDAP1 26..98 CDD:239350 18/69 (26%)
GST_C_GDAP1 179..289 CDD:198336 20/107 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.