DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Gsto2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:174 Identity:38/174 - (21%)
Similarity:73/174 - (41%) Gaps:38/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDN-LFVIWETR 66
            :|:|...|.:....:..||..:....|.:|.   :....|:...:|...:|.|.:: ..:|:|:.
  Rat    26 IYSMRFCPYSHRTRLVLKAKSIRHEIININL---KNKPDWYYTKHPFGQVPVLENSQCQLIYESV 87

  Fly    67 AIVVYLVEQYGKDD-----SLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGT--- 123
            ....||      ||     .|:|.||.::|  .|::..::......::|.....||.|:..|   
  Rat    88 IACEYL------DDVFPGRKLFPYDPYERA--RQKMLLELFCKVPQLSKECLVALRCGRDCTDLK 144

  Fly   124 ----QE--NLEKLNAAFDLLNNFLDGQD--YVAGNQLSVADIVI 159
                ||  |||::          |:.|:  :..|:.:|:.|.::
  Rat   145 VALRQELCNLEEI----------LEYQNTTFFGGDSISMIDYLV 178

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 15/71 (21%)
PLN02395 11..208 CDD:166036 35/166 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 17/83 (20%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 15/76 (20%)