DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Eef1g

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:150 Identity:33/150 - (22%)
Similarity:73/150 - (48%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWFVKINPQHTIPTLV-DNLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTL 104
            |.|::..|...:|... |:.|.::|:.||..|:     .::.|....|:..|.:.|.:.|....:
  Rat    47 PEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV-----SNEELRGSTPEAAAQVVQWVSFADSDI 106

  Fly   105 YDGIAKYFFP---LLRTGKPGTQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATV--S 164
            ....:.:.||   ::...|..|:...|::.....||:..|..:.::.|.::::|||.::.|:  .
  Rat   107 VPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWL 171

  Fly   165 TTEMVDFDLKK-FPNVDRWY 183
            ..::::...:: |||.:||:
  Rat   172 YKQVLEPSFRQAFPNTNRWF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 10/33 (30%)
PLN02395 11..208 CDD:166036 33/149 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/101 (21%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 10/39 (26%)
maiA 5..187 CDD:273527 30/144 (21%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 21/100 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.