DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Eef1e1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001099576.1 Gene:Eef1e1 / 291057 RGDID:1311056 Length:174 Species:Rattus norvegicus


Alignment Length:146 Identity:39/146 - (26%)
Similarity:71/146 - (48%) Gaps:23/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEKLNA 132
            |..:||::..| :.|.....:::||:.|.|.|.: |..||         .:.|..||..|:.   
  Rat    47 IATHLVKEANK-EHLLGSTAEEKALVQQWLEFRI-TRVDG---------HSSKEDTQTLLKD--- 97

  Fly   133 AFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDF---DLKKFPNVDRWYKNAQKVTPGWD 194
                ||::|:.:.|:||:..::|||::...:... :||.   :.:|:.||.||:.:.|.. |...
  Rat    98 ----LNSYLEDKVYLAGHNTTLADILLYYGLHRF-IVDLTVQEKEKYLNVSRWFCHIQHY-PDIR 156

  Fly   195 ENLARIQSAKKFLAEN 210
            ::|:.:...|..|..|
  Rat   157 QHLSSVVFIKNRLYAN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 2/5 (40%)
PLN02395 11..208 CDD:166036 37/142 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/118 (26%)
Eef1e1NP_001099576.1 GST_C_AIMP3 65..165 CDD:198338 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.