DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gst-34

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_741060.2 Gene:gst-34 / 260015 WormBaseID:WBGene00001782 Length:218 Species:Caenorhabditis elegans


Alignment Length:201 Identity:45/201 - (22%)
Similarity:85/201 - (42%) Gaps:52/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
            |:::.|.|.....|.|...|    ..||.:.|:..:.:      .|....|.|..:.|.:.::.|
 Worm    21 LFHLGGVPYEDVRMPTDDIV----PGIQSDAFLALKDK------TPFGRFPVLSIDGFDLAQSTA 75

  Fly    68 IVVYLVEQYGKDDSLYP-KDPQKQALINQRLYFDMGTLYDGIAKY---FFPLL---RTGKPGTQE 125
            |..||..::|     |. |.|:.:|..:        ::.|.:.:|   |.|||   ::|||  :|
 Worm    76 IHRYLARKFG-----YAGKSPEDEAFAD--------SIVDQVKEYLESFRPLLYAQKSGKP--EE 125

  Fly   126 NLEKL---------NAAFDLLNNFL--DGQDYVAGNQLSVADIVI---------LATVSTTEMVD 170
            .::::         |..|.:|...|  ...:|:.|:.|:.||:|:         :..:...:.:.
 Worm   126 EVKRIHDEVYIPVKNLLFKILTRILKESKSEYLVGDGLTWADLVVADHLYSLTNIKELDPEDPIH 190

  Fly   171 FDLKKF 176
            .:|||:
 Worm   191 LNLKKY 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/70 (24%)
PLN02395 11..208 CDD:166036 42/193 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/115 (21%)
gst-34NP_741060.2 GST_N_Sigma_like 4..82 CDD:239337 17/70 (24%)
PTZ00057 6..213 CDD:173353 45/201 (22%)
GST_C_Sigma_like 92..200 CDD:198301 24/115 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.