Sequence 1: | NP_524915.1 | Gene: | GstD6 / 48339 | FlyBaseID: | FBgn0010042 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741061.2 | Gene: | gst-35 / 259481 | WormBaseID: | WBGene00001783 | Length: | 218 | Species: | Caenorhabditis elegans |
Alignment Length: | 216 | Identity: | 54/216 - (25%) |
---|---|---|---|
Similarity: | 93/216 - (43%) | Gaps: | 57/216 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67
Fly 68 IVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKY---FFPLL---RTGKPGTQEN 126
Fly 127 LEKL---------NAAFDLLNNFL--DGQDYVAGNQLSVADIVI---LATVSTTEMVDFD----- 172
Fly 173 -LKKF-------PNVDRWYKN 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD6 | NP_524915.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 19/70 (27%) |
PLN02395 | 11..208 | CDD:166036 | 51/208 (25%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 32/131 (24%) | ||
gst-35 | NP_741061.2 | GST_N_Sigma_like | 4..82 | CDD:239337 | 19/70 (27%) |
PTZ00057 | 6..215 | CDD:173353 | 54/216 (25%) | ||
GST_C_Sigma_like | 92..200 | CDD:198301 | 29/117 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |