DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and CLIC4

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_039234.1 Gene:CLIC4 / 25932 HGNCID:13518 Length:253 Species:Homo sapiens


Alignment Length:207 Identity:42/207 - (20%)
Similarity:85/207 - (41%) Gaps:69/207 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLYNMSGSPSTRAVMMTAKA-VGVEFNSIQVNTFVGEQL-EPWFVKINPQHTIPTLVDNLFVIWE 64
            ||.|:  :|.|....:|..: |..:.|.|:  .|:.|.| .|.::|::|:|.            |
Human    65 DLQNL--APGTHPPFITFNSEVKTDVNKIE--EFLEEVLCPPKYLKLSPKHP------------E 113

  Fly    65 TRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEK 129
            :....:.:..::    |.|.|:.:.:|  |:.|                      :.|..:.|:|
Human   114 SNTAGMDIFAKF----SAYIKNSRPEA--NEAL----------------------ERGLLKTLQK 150

  Fly   130 LNAAFDLLNNFLDGQ--------------DYVAGNQLSVADIVILATVSTTEMV-----DFDL-K 174
            |:   :.||:.|..:              .::.||::::||..:|..:...::|     :||: |
Human   151 LD---EYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPK 212

  Fly   175 KFPNVDRWYKNA 186
            :...:.|:..||
Human   213 EMTGIWRYLTNA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/73 (23%)
PLN02395 11..208 CDD:166036 38/198 (19%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/119 (18%)
CLIC4NP_039234.1 Required for insertion into the membrane. /evidence=ECO:0000305 2..101 12/39 (31%)
O-ClC 17..252 CDD:129941 42/207 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.