DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gst2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:61/227 - (26%)
Similarity:102/227 - (44%) Gaps:37/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVD---NLFVIWE 64
            ||:.:|.|:...|::..|.:.:.:..|..:...|||.....:.:||...:|||||   |.:.|||
pombe     6 LYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNNDYTIWE 70

  Fly    65 TRAIVVYLVEQYGKDD--SLYPKDPQKQALINQRLYFD---MGTLYDGIAKYF-----FPLLRTG 119
            :.||::||.::|..|.  ||...||:...|| |.|:|.   .|.:: |.|.:|     .|::   
pombe    71 SDAILIYLADKYDTDRKISLSFDDPEYYKLI-QYLFFQASGQGVIW-GQAGWFNFFHHEPVV--- 130

  Fly   120 KPGTQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVIL------------ATVSTTEMV--- 169
             ........::.....:|.:.|..:||:..|:.::||:..:            ...|..|.|   
pombe   131 -SAVTRYRNEIKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKFSFKEEVPQL 194

  Fly   170 DFDLKKFPNVDRWYKN--AQKVTPGWDENLAR 199
            ||: |:||....|.:.  |:.......|.||:
pombe   195 DFE-KEFPKAYAWNQRLLARPAVKATFEELAK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 25/73 (34%)
PLN02395 11..208 CDD:166036 57/219 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/137 (22%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 26/77 (34%)
GstA 5..226 CDD:223698 61/227 (27%)
GST_C_Ure2p 96..219 CDD:198326 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.