DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gst1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:223 Identity:52/223 - (23%)
Similarity:100/223 - (44%) Gaps:44/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVD---NLFVIWE 64
            |::.:..|:...|:...|.:.:.:.:..||....||..|..:.:||...:|||:|   |.:.|||
pombe     6 LWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNNDYTIWE 70

  Fly    65 TRAIVVYLVEQYGKDDSL-YPKDPQKQALINQRLYFD---MGTLYDGIAKYFFPLLRTGKPGTQE 125
            :.||::||.::|..:..: .|:|..:...:.|.|:|.   .|.:: |.|.:|       ....||
pombe    71 SDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIW-GQAGWF-------SVYHQE 127

  Fly   126 NL--------EKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMV------------- 169
            .:        .::.....:|.:.|..:||:..|:.::||:..::..:..|::             
pombe   128 LVISAITRYRNEIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGKFSIEEEVP 192

  Fly   170 --DFDLKKFPNVDRWYKN-----AQKVT 190
              ||: |:||....|::.     |.|.|
pombe   193 QLDFE-KEFPRTYSWHQRLLARPASKAT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 23/73 (32%)
PLN02395 11..208 CDD:166036 50/215 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/134 (19%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 24/77 (31%)
GstA 5..218 CDD:223698 50/220 (23%)
GST_C_Ure2p 96..219 CDD:198326 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.