DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GstT2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:220 Identity:62/220 - (28%)
Similarity:98/220 - (44%) Gaps:34/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SPSTRAVMMTAKAVG--VEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRAIVVY 71
            ||..|.:.:..|...  ||:..|.:..|  |||...:.|||....:|.:|...|.:.||.||:.|
  Fly    13 SPIARGLWIGLKFSNSPVEYCPIALRKF--EQLTDEYKKINRFQKVPAIVGGDFHLSETIAIIRY 75

  Fly    72 LVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYF-----FPLLRTG-----KP----- 121
            |.::...|:.||||..:.:|.:::.|.:....:....:.||     ||:  .|     ||     
  Fly    76 LADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPM--NGIAPKPKPEQIQA 138

  Fly   122 ---GTQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDF--DLKKFPNVDR 181
               |.:.||..|...:  |.|     |::.|..|::|||:..:.::...:..:  |.||||.|.:
  Fly   139 LIEGVENNLGLLERLW--LEN-----DFLVGKNLTMADILGSSEINQLRLCQYRVDEKKFPKVVK 196

  Fly   182 WYKNAQ-KVTPGWDENLARIQSAKK 205
            |.:..: ...|..||.|..|....|
  Fly   197 WLERVRVSANPYHDEGLTFIDRKSK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 23/66 (35%)
PLN02395 11..208 CDD:166036 60/218 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/136 (24%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 23/68 (34%)
GstA 7..202 CDD:223698 56/199 (28%)
GST_C_family 93..218 CDD:295467 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.