| Sequence 1: | NP_524915.1 | Gene: | GstD6 / 48339 | FlyBaseID: | FBgn0010042 | Length: | 215 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035820.3 | Gene: | Vars1 / 22321 | MGIID: | 90675 | Length: | 1263 | Species: | Mus musculus |
| Alignment Length: | 140 | Identity: | 35/140 - (25%) |
|---|---|---|---|
| Similarity: | 48/140 - (34%) | Gaps: | 52/140 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 114 PLLRTGKPG--TQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKF 176
Fly 177 P-------NVDRW-------------------YKNAQKVT--PGWD------------------E 195
Fly 196 NLARIQSAKK 205 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstD6 | NP_524915.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | |
| GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 34/137 (25%) | ||
| Vars1 | NP_035820.3 | GST_C_family | 92..213 | CDD:470672 | 26/99 (26%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 218..294 | 6/35 (17%) | |||
| PTZ00419 | 281..1263 | CDD:240411 | |||
| 'HIGH' region | 343..353 | ||||
| 'KMSKS' region | 861..865 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||