DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Vars1

DIOPT Version :10

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_035820.3 Gene:Vars1 / 22321 MGIID:90675 Length:1263 Species:Mus musculus


Alignment Length:140 Identity:35/140 - (25%)
Similarity:48/140 - (34%) Gaps:52/140 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PLLRTGKPG--TQENLEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKF 176
            |.|....||  .|..|..|..|.:.|.::|....|:||:..::||   ||.| |..::.|.....
Mouse   117 PALGLRGPGQDPQAALGALGKALNPLEDWLRLHTYLAGDAPTLAD---LAAV-TALLLPFRYVLD 177

  Fly   177 P-------NVDRW-------------------YKNAQKVT--PGWD------------------E 195
            |       ||.||                   |..|:.||  ||.:                  |
Mouse   178 PSARRIWGNVTRWFNTCVRQPEFRAVLGEVALYSGARSVTQQPGSEVIAPQKTPAQLKKEAKKRE 242

  Fly   196 NLARIQSAKK 205
            .|.:.|..:|
Mouse   243 KLEKFQQKQK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 34/137 (25%)
Vars1NP_035820.3 GST_C_family 92..213 CDD:470672 26/99 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..294 6/35 (17%)
PTZ00419 281..1263 CDD:240411
'HIGH' region 343..353
'KMSKS' region 861..865
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.