DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gst-43

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:144 Identity:41/144 - (28%)
Similarity:66/144 - (45%) Gaps:7/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FVKINPQHTIPTLVDNLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDG 107
            |||.||...:||||.|...:.|:.||:.||.|.| .|....||:..|::.........:.::...
 Worm    47 FVKHNPAKKVPTLVINGLSLTESLAIIEYLDEAY-PDPPFLPKELDKRSYSRAIALHIVASIQPL 110

  Fly   108 IAKYFFPLLRTGKPGTQE---NLEKLNAAFDLLNNFLDGQD--YVAGNQLSVADIVILATVSTTE 167
            .|.....:|...:||..:   | ..:|..|..|...|....  |..|:||::|||.:.:.:...:
 Worm   111 QAINIHKMLNEKEPGYGDFWCN-HFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAK 174

  Fly   168 MVDFDLKKFPNVDR 181
            :...|:.|:|.:.|
 Worm   175 IYKVDMSKYPTITR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 15/30 (50%)
PLN02395 11..208 CDD:166036 41/144 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/99 (21%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 14/29 (48%)
maiA 5..211 CDD:273527 41/144 (28%)
GST_C_Zeta 90..207 CDD:198300 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.