DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gst-15

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_496860.1 Gene:gst-15 / 185410 WormBaseID:WBGene00001763 Length:213 Species:Caenorhabditis elegans


Alignment Length:168 Identity:45/168 - (26%)
Similarity:75/168 - (44%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PQHTIPTLVDNLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYF 112
            |...:|.|..:.|.|.::.||..||.:::|.......::....|:::|...|.:.         |
 Worm    51 PFGQLPVLNVDGFDIPQSAAICRYLAKKFGYAGKTPEEEAWADAVVDQFKDFSVA---------F 106

  Fly   113 FPLL---RTGKPGTQENLEKL-----NAA----FDLLNNFL--DGQDYVAGNQLSVADIVI---L 160
            ..||   |.|||  :|.:.|:     |.|    |.|||..|  ....|:.|:.|:.||:||   |
 Worm   107 KTLLFATRAGKP--EEEILKIRYEIFNPARDVYFILLNRILKKSKSGYLVGDGLTWADLVIADNL 169

  Fly   161 ATVSTTEMVDFDLKKFPNVDRWYKNAQKVTPGWDENLA 198
            .::.....:|.|.:...|:.: ||.....||..::::|
 Worm   170 HSLEKLRAIDDDDEGHQNLKK-YKEKIYGTPDLEDHIA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 9/25 (36%)
PLN02395 11..208 CDD:166036 45/168 (27%)
GST_C_Delta_Epsilon 88..204 CDD:198287 35/128 (27%)
gst-15NP_496860.1 GST_N_Sigma_like 4..77 CDD:239337 9/25 (36%)
PTZ00057 6..211 CDD:173353 45/168 (27%)
GST_C_Sigma_like 87..195 CDD:198301 32/119 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.