DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gst-14

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans


Alignment Length:239 Identity:59/239 - (24%)
Similarity:100/239 - (41%) Gaps:53/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLYNMSGSPSTRAVMMTAKAV----GVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFV 61
            |..|.:|..| .|.:..:|:.:    ||.|...:|| |:.:..|....| .|...:|.|..:.|.
 Worm     1 MPSYKLSYFP-VRGLAESARLLFHLAGVPFEDERVN-FLDDTWEKMKGK-TPMGQLPVLTVDDFE 62

  Fly    62 IWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYF--FPLL----RTGK 120
            |.::.||..||..::|    ...|.|:::|.::        .:.|....:|  |..|    |.||
 Worm    63 IPQSAAINRYLARKFG----FAGKTPEEEAWVD--------AVVDQFKDFFAEFRKLVIAKRVGK 115

  Fly   121 PGTQENLEKLNAA---------FDLLNNFLD--GQDYVAGNQLSVADIVILATVSTTEMVDFDLK 174
              :.|.||||.|.         |.:||..|:  ...|:.|:.::.||:.|...:.|       ||
 Worm   116 --SAEELEKLTAEVIKPAMDVYFKVLNGLLEKSKSGYLIGDSITFADLYIADNIQT-------LK 171

  Fly   175 KFPNVDRWYKNAQKVTPGWDENLARIQS---AKKFLAENLIEKL 215
            |:..::     |....|....:|.::.|   .|.::|...:.::
 Worm   172 KYGLLE-----ASGEQPKLAAHLEKVYSHPNLKSYIASRPVTEI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 23/76 (30%)
PLN02395 11..208 CDD:166036 54/220 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/135 (23%)
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 22/73 (30%)
PTZ00057 6..205 CDD:173353 57/227 (25%)
GST_C_Sigma_like 85..192 CDD:198301 30/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.